PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.3333s0010.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family HB-other
Protein Properties Length: 241aa    MW: 26034.5 Da    PI: 4.9116
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.3333s0010.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-182682157
                            TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                            ++kR   +++qle+Le+ +  + yps+  r+eL+ +lgL++rq ++WF+ rR k++k
  SapurV1A.3333s0010.1.p 26 KSKRKMKSASQLEILEKIYSVDTYPSEVVRAELSVQLGLSDRQLQMWFCHRRLKDRK 82
                            6799***************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-171382IPR009057Homeodomain-like
SuperFamilySSF466891.88E-162082IPR009057Homeodomain-like
PROSITE profilePS5007116.2442383IPR001356Homeobox domain
SMARTSM003898.9E-152587IPR001356Homeobox domain
PfamPF000463.4E-162682IPR001356Homeobox domain
CDDcd000866.24E-162682No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MEEAAADGGG VEVEAKNKTP GEGESKSKRK MKSASQLEIL EKIYSVDTYP SEVVRAELSV  60
QLGLSDRQLQ MWFCHRRLKD RKAPSVKRPC KESPSLAGMP GGGETGVVAE VGNEHGSGSS  120
PFVLGVDPRR AVGRPTGVAV PRISADVQTM NRYYEPQQSI AELRAIAFVE AQLGEPLRED  180
GPILGMEFDP LPPDAFGAPI DLVSPRSMIF SQDSRGISEL VPFQGVFDWG MKGSCETFYC  240
*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011047701.11e-137PREDICTED: uncharacterized protein LOC105141971 isoform X4
RefseqXP_011047698.11e-136PREDICTED: uncharacterized protein LOC105141971 isoform X1
SwissprotQ9FFH13e-47RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLB9HGS01e-110B9HGS0_POPTR; Uncharacterized protein
STRINGPOPTR_0007s01330.11e-109(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15781611
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.23e-47Homeodomain-like transcriptional regulator